PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1317s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family NF-YA
Protein Properties Length: 320aa    MW: 34919.1 Da    PI: 9.6811
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1317s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA91.41.2e-28153209158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          d p++VNaKQy++I++RR  Rak+e  kk  + +rkpy+heSRh hA+rR Rg+gGrF
  Kalax.1317s0003.1.p 153 DGPIFVNAKQYHGIIRRRLYRAKAELVKKS-IGARKPYMHESRHLHAMRRVRGCGGRF 209
                          57************************9999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.2E-32151212IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115232.765152212IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-25155209IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-21155177IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860157177IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-21186209IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MQTVYLKEYE GMSENTIGHL SSGQTMPWWA AESHSDPAEA FRHLKSSPVE HATAGRQFTL  60
TKSDHSRTLK GAEKAAANQF TISPGGQRAQ QVRASVNIQP ILSDYDTHLE PGYGQAMVYP  120
KYPYGDQSFW AMSTYGPQVQ GRVMLPQNST ADDGPIFVNA KQYHGIIRRR LYRAKAELVK  180
KSIGARKPYM HESRHLHAMR RVRGCGGRFL NTKVSDAGTG GNSMKFASDA ILSRPTDSPS  240
SGIFQSDSGN LNSPKQANSD MSNISGSEAT SAYTRGDLRC WTTNFLGPSI PAMMDTRHGM  300
IAAPSHWVAA AQNCCNPNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-15153217266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A3e-15153210260HAPB protein
4g92_A3e-15153210260HAPB protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008387119.11e-100PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLF6I3K72e-98F6I3K7_VITVI; Putative uncharacterized protein
STRINGVIT_08s0032g01190.t015e-98(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-45nuclear factor Y, subunit A10